PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000708692
Common NameWRKY9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 521aa    MW: 57709 Da    PI: 7.5962
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000708692genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY105.82.3e-33221278260
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                    dDg+nWrKYGqK+vkgse+prsYY+Ct+++Cp+kkkvers  d+++++i+Y+g+Hnh+k
  MDP0000708692 221 DDGFNWRKYGQKQVKGSENPRSYYKCTFPNCPTKKKVERSL-DGQITQIVYKGSHNHPK 278
                    8****************************************.***************85 PP

2WRKY106.11.8e-33385443159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Cts gCpv+k+ver+++d+k+v++tYeg+Hnh+
  MDP0000708692 385 LDDGYRWRKYGQKVVKGNPNPRSYYKCTSVGCPVRKHVERASHDTKAVITTYEGKHNHD 443
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.548215279IPR003657WRKY domain
Gene3DG3DSA:2.20.25.802.8E-28215279IPR003657WRKY domain
SuperFamilySSF1182905.89E-25219279IPR003657WRKY domain
SMARTSM007742.8E-36220278IPR003657WRKY domain
PfamPF031062.4E-25221277IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.4E-37370445IPR003657WRKY domain
SuperFamilySSF1182902.09E-29377445IPR003657WRKY domain
PROSITE profilePS5081138.802380445IPR003657WRKY domain
SMARTSM007743.2E-39385444IPR003657WRKY domain
PfamPF031061.2E-25386443IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0010120Biological Processcamalexin biosynthetic process
GO:0010200Biological Processresponse to chitin
GO:0010508Biological Processpositive regulation of autophagy
GO:0042742Biological Processdefense response to bacterium
GO:0050832Biological Processdefense response to fungus
GO:0070370Biological Processcellular heat acclimation
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MTSSFTNLLT SNMENNGIGQ DRTNWGGQFS DYSSNPNRFT DRNGTEIPKF RSLQPPSLPL  60
SPPPVSPSSY LASTPAFSPT DFFSSPMFLS SSNNLESPTT GAFSSQIFDW VNNSKDTQQG  120
IRESEPKMFS DFSFQPESRP ATNLQSASSM VSVEEPFKRE RQAWDFSTTR QADSSAEKTG  180
VKSEFEPIEA NTQSNGLNGA PKSDYLHSTQ SSQYGREQKS DDGFNWRKYG QKQVKGSENP  240
RSYYKCTFPN CPTKKKVERS LDGQITQIVY KGSHNHPKPQ STRRSSSNAI QGSSYVISDQ  300
SVPTLSNPKV ESITLQEDSS TSMGEDEFEQ NSPISNSGGA EDENEPEAKR WKGENANDQA  360
YVSSGSRIVK EPRIVVQTTS EIDILDDGYR WRKYGQKVVK GNPNPRSYYK CTSVGCPVRK  420
HVERASHDTK AVITTYEGKH NHDVPAARGS GNYSNASRPA ADNSSNNVSM AVRPLALPNH  480
SNLRYLNSLQ NTRQPSTTES QPPFTLKMLQ SEGSYGFSEF *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A5e-38221446878Probable WRKY transcription factor 4
2lex_A5e-38221446878Probable WRKY transcription factor 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.158840.0fruit| leaf| stem
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00299DAPTransfer from AT2G38470Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001281056.10.0probable WRKY transcription factor 33
SwissprotQ8S8P51e-117WRK33_ARATH; Probable WRKY transcription factor 33
TrEMBLD9ZJG30.0D9ZJG3_MALDO; WRKY domain class transcription factor
STRINGPOPTR_0016s13600.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF107734114
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38470.11e-118WRKY DNA-binding protein 33